PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.U1RSV
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 489aa    MW: 56974 Da    PI: 10.3833
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.U1RSVgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.21.5e-1322112298
                  EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  fk+ + + +l+ + + lp kf+e++g+    s  l l+ ++g +W+v    ++++g+++++kGWkeFv    L+ g  + F ++   + ++ v++f+
  Araip.U1RSV  22 FKIIL-KQALQDDDFKLPIKFTEKYGSG--LSNPLYLKPPDGTEWRVDW--TNQDGEILFKKGWKEFVAYYSLDHGHLLWFDYNI-GTSHMEVHIFD 112
                  55554.44556667***********755..6667***************..*******************************963.45556888886 PP

2B342.61.1e-132803641299
                  HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +++  +++ kf++++ ++++++  +++     + + vkliyr +s+  ++++GW+ F++a +L++gD+++Fkl++r++  + v+++r+
  Araip.U1RSV 280 TRAPCYFSTKFFRKYFENNPQNANIRFG---KKLFPVKLIYRPSSCVAFISAGWNLFARASQLQAGDVCLFKLINRKDPVFDVHICRR 364
                  4444577899999997676777777754...499****************************************9999989*****98 PP

3B347.14.4e-154054871399
                  TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  ++r  l+  f +++ +k+++  +++l+    +sW  ++iy+ +s+  ++++GW++F++a +L++gD++vF+l+++++  + v+++r+
  Araip.U1RSV 405 RSRPNLSAIFYRKYFKKNQQ--DVKLQF-GKESWPATIIYNPTSKNSFISAGWSSFARASKLEAGDVCVFELINEKDL-FDVHICRA 487
                  55667888899999766445..566544.669*****************************************97444.69999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.1E-1814113IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-1715113IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.30720114IPR003340B3 DNA binding domain
CDDcd100177.13E-1120112No hitNo description
SMARTSM010191.1E-621114IPR003340B3 DNA binding domain
PfamPF023629.7E-1123112IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-12265364IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.4E-15266364IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.2E-5270365IPR003340B3 DNA binding domain
PfamPF023625.6E-12280365IPR003340B3 DNA binding domain
CDDcd100178.22E-11285363No hitNo description
PROSITE profilePS508639.234311365IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.2E-20386488IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-17387487IPR015300DNA-binding pseudobarrel domain
CDDcd100177.87E-15392486No hitNo description
PROSITE profilePS5086311.011393488IPR003340B3 DNA binding domain
SMARTSM010193.7E-12394488IPR003340B3 DNA binding domain
PfamPF023627.3E-13409487IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MASSSSQQNK HSPSTSTVIS FFKIILKQAL QDDDFKLPIK FTEKYGSGLS NPLYLKPPDG  60
TEWRVDWTNQ DGEILFKKGW KEFVAYYSLD HGHLLWFDYN IGTSHMEVHI FDMGCLQIEY  120
PDNDQIKEQL PRRDQQSVKR PEEQKTRHVD SSPSTQNMRL NEGPQKKRLN ELPREVRGQP  180
TKKLRALVSS ASKSRQLEND TQIRDVERSL NSHGIKSKEK NREMLVSVNQ DYNGKRNRRR  240
KDSESSIRPC PARPESLKEA KKFKWEKPTF IIKITQRSQT RAPCYFSTKF FRKYFENNPQ  300
NANIRFGKKL FPVKLIYRPS SCVAFISAGW NLFARASQLQ AGDVCLFKLI NRKDPVFDVH  360
ICRRQRRESL SKPVTHVIQL PKEVKELNSQ NPSFMVKIRD SDPRRSRPNL SAIFYRKYFK  420
KNQQDVKLQF GKESWPATII YNPTSKNSFI SAGWSSFARA SKLEAGDVCV FELINEKDLF  480
DVHICRAQC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182534.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15597210
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-23B3 family protein